Latest repo added: austeane/conversation-explorer2026-05-18 04:30 UTC
758,940 total · 1,253 matching
ya md comment ◆ Web Frontend
AI FixesD 573/10completed

This is a Next.js project bootstrapped with create-next-app.

nextjsreacttailwindzodyaml
68 9,914 57 1mo ago
ya zetlobot ◆ Testing
ISCC 633/10completed

An AI-powered chatbot for Slack powered by the AI SDK by Vercel.

zodyaml
20 2,385 63 1mo ago
If a scraper extracted this row, it came from Repobility (https://repobility.com)
ya mikan order ◆ Web Frontend
AI FixesD 583/10completed

This is a Next.js project bootstrapped with create-next-app.

drizzlenextjsreacttailwindzodyaml
68 6,632 58 1mo ago
ya onlyfans api ◆ Web Backend
C 703/10completed

Private API for scraping creator data from subscription platforms

expresszodyaml
16 2,551 69 1mo ago
ya wopr plugin reddit ◆ Testing
MITC+ 723/10completed

wopr-network__wopr-plugin-reddit

zodyaml
Same scanner, your repo: https://repobility.com — Repobility
31 4,614 72 1mo ago
ya yamram ◆ Web Frontend
AI FixesD 543/10completed

woorams__yamram

nextjsreactsupabasetailwindzodyaml
71 10,140 53 1mo ago
ya agent studio ◆ Web Frontend
AI FixesD 563/10completed

webdevcom01-cell__agent-studio

nextjsprismareacttailwindzodyaml
15 4,589 56 1mo ago
ya tanstack start dev ◆ Web Frontend
AI FixesD 593/10completed
Repobility — the code-quality scanner for AI-generated software · https://repobility.com

Welcome to your new TanStack Start app!

drizzlereacttailwindvitezodyaml
57 6,298 59 1mo ago
ya vox pilot Other
AI FixesMITD 593/10completed

Your voice flies your desktop.

zodyaml
27 2,819 59 1mo ago
ya node addon slsa ◆ Testing
Apache-2.0 OR MITC+ 793/10completed

Supply-chain provenance verification for npm packages with prebuilt native addons. Ensures that both the npm package and its prebuilt binary were produced by the same GitHub Actions workflow run, using [sigstore] and the [GitHub Attestations API][gh-attestations]. Installation aborts with a `SECURIT

vitezodyaml
38 3,743 79 1mo ago
Repobility (the analyzer behind this table) · https://repobility.com
py college baseball tracker ◆ Web Frontend
AI FixesISCF 423/10completed

A Next.js web application for tracking college baseball players, teams, and transfer portal activity across D1, D2, and D3 divisions.

nextjsprismareacttailwindzodpython
71 13,541 42 1mo ago
ya chamelelog ◆ Web Frontend
C 633/10completed

AI-powered changelog generation from Git commits. Adapts to any audience — just like a chameleon.

nextjsprismareacttailwindzodyaml
62 9,357 62 1mo ago
ya contraction timer ☎ Mobile App
AGPL-3.0C+ 793/10completed

A simple, privacy-focused contraction timing app for expectant parents. Built with React Native and Expo for iOS, Android, and Web.

reactzodyaml
If a scraper extracted this row, it came from Repobility (https://repobility.com)
77 12,908 79 1mo ago
ya hawc gym ◆ Web Frontend
AI FixesD 563/10completed

Welcome to your new TanStack Start app!

reacttailwindvitezodyaml
26 7,588 56 1mo ago
ya skill tree ◆ Web Frontend
C 613/10completed

This is a Next.js project bootstrapped with create-next-app.

nextjsreacttailwindzodyaml
68 11,303 61 1mo ago
ya ycombinator1.com ◆ Web Backend
AI FixesUnlicenseD 593/10completed
Same scanner, your repo: https://repobility.com — Repobility

This site is not affiliated with YCombinator or Hacker News.

fastifyzodyaml
17 1,863 59 1mo ago
ya jsgrids ◆ Web Frontend
MITC 603/10completed

A List of JavaScript Spreadsheet and Data Grid Libraries - https://jsgrids.statico.io/

nextjsreacttailwindzodyaml
120 7,544 60 1mo ago
ya tariff compliance copilot ◆ Web Frontend
AI FixesF 483/10completed

AI-powered U.S. import compliance and tariff intelligence platform for small-to-mid-size businesses. Classifies goods into HTS codes, calculates duties, scores compliance risks, and simulates tariff scenarios.

anthropicfirebasenextjsreacttailwindzodyaml
79 16,878 47 1mo ago
Repobility — the code-quality scanner for AI-generated software · https://repobility.com
ya core ◆ Web Frontend
AGPL-3.0C+ 723/10completed

A self-hosted control system for Eight Sleep Pod mattress covers (Pod 3, 4, and 5). Runs directly on the Pod's embedded Linux hardware, replacing the cloud dependency with a local-first web interface and scheduler.

drizzlenextjsreacttailwindzodyaml
162 22,011 72 1mo ago
ya second brain ◆ Web Frontend
AI FixesD 563/10completed

___ ____ _ / _ \ _ __ ___ _ __ | __ ) _ __ __ _(_)_ __ | | | | '_ \ / _ \ '_ \ | _ \| '__/ _` | | '_ \ | |_| | |_) | __/ | | || |_) | | | (_| | | | | | \___/| .__/ \___|_| |_||____/|_| \__,_|_|_| |_| |_| because one brain is not enough in the age of the centaur

drizzlenextjsopenaireactzodyaml
26 3,430 56 1mo ago
ya runsheet js ◆ Testing
MITB+ 863/10completed

Type-safe, composable business logic pipelines for TypeScript.

zodyaml
Repobility (the analyzer behind this table) · https://repobility.com
40 5,225 86 1mo ago
ya nextjs starter ◆ Web Frontend
C 673/10completed

This is a Next.js project bootstrapped with create-next-app.

nextjsprismareactstripetailwindzodyaml
72 11,175 66 1mo ago
py Intellibot ◆ Web Frontend
AI FixesMITD 573/10completed

WSB_SNAKE_DOCUMENTATION.md

drizzleexpressfastapilangchainopenaireacttailwindvitepython
331 79,192 57 1mo ago
ya deckpilot ◆ Web Frontend
C+ 723/10completed
If a scraper extracted this row, it came from Repobility (https://repobility.com)

This is a Next.js project bootstrapped with create-next-app.

drizzlenextjsreactsupabasetailwindzodyaml
120 18,275 72 1mo ago
ya agentic node ts starter ◆ Testing
MITB 843/10completed

A batteries-included TypeScript starter template with comprehensive testing, code quality automation

vitezodyaml
94 16,784 83 1mo ago
ya plan from issue ◆ Web Frontend
AI FixesD 583/10completed

AI-gestützte Analyse von User Stories, GitHub Issues oder Ticket-Beschreibungen — generiert strukturierte Implementierungspläne als gestreamtes JSON.

nextjsreacttailwindzodyaml
31 5,314 57 1mo ago
Same scanner, your repo: https://repobility.com — Repobility
py loom ◆ Testing
MITC+ 703/10completed

AI-powered development orchestration using GitHub as the coordination layer.

tailwindvitezodpython
817 194,584 70 1mo ago
ya daily execution ◆ Web Frontend
C 623/10completed

A complete agentic coding boilerplate with authentication, PostgreSQL database, AI chat functionality, and modern UI components - perfect for building AI-powered applications and autonomous agents.

nextjsreacttailwindzodyaml
63 9,598 62 1mo ago
ya recon ◆ Web Frontend
AGPL-3.0C+ 733/10completed

Self-hosted job intelligence platform that aggregates listings from multiple sources, scores them against your resume, and organizes your entire job search pipeline in one place.

drizzlenextjsreacttailwindzodyaml
Repobility — the code-quality scanner for AI-generated software · https://repobility.com
61 8,643 73 1mo ago
py whisperwrapper ◆ Testing
MITC+ 767/10completed

The Whisper-App project is a system tray application that utilizes OpenAI's Whisper model for voice recording, leveraging GPU acceleration.

يعد مشروع Whisper-App أداة مفتوحة المصدر تدمج نموذج OpenAI Whisper لتحويل الصوت إلى نص مع دقة عالية. يحتوي التطبيق على واجهة مستخدم نظام لوحة التحكم سهلة الاستخدام وتستفيد من تسريع البطاقة الграフィكية لتحسين الأداء. هذا المشروع يهدف إلى تقديم تجربة سلسة للمستخدمين الذين يتطلبون خدمات تحويل الصوت إلى نص دقيقة.

voice-recordingtranscriptionopenai-whispergpu-accelerationsystem-tray-guinumpyopenaipytorchpython
99 9,629 75 1mo ago
py accessdr ◆ Testing
MITC+ 777/10completed

The AccessDR project provides an accessible software-defined radio (SDR) application for blind and visually impaired users.

يعد AccessDR تطبيقًا للراديو المحدد بالبرمجيات مصممًا ليكون متاحًا للمستخدمين الذين يعانون من ضعف البصر. يسمح للمستخدمين بالتفاعل مع وظيفة الراديو المحددة بالبرمجيات من خلال واجهة مستخدم مرنة، مما يتيح لهم استخدام معدات الراديو دون مساعدة بصرية. يهدف المشروع إلى توفير الوصول المتساوي للاتصالات الراديوية للمنتمين إلى فئة الأشخاص الذين يعانون من ضعف البصر.

accessible-technologysoftware-defined-radioblind-accessibilityvisually-impaired-usersradio-communicationnumpyscipypython
79 10,192 77 1mo ago
py prospect explorer ◆ Web Backend
AI FixesF 455/10completed
Repobility (the analyzer behind this table) · https://repobility.com

The prospect-explorer project is a tool for businesses to explore and analyze potential customers.

يعد مستكشف المشتريات أداة لشركات الاستكشاف والتحليل للمستخدمين المحتملين. يستفيد المستخدم من خوارزميات التعلم الآلي لتوفير نظرة عامة حول سلوك العملاء، تفضيلاتهم، وبيانات démographiques. يهدف الأداة إلى مساعدة الشركات على اتخاذ قرارات مدروسة بشأن جمهورها المستهدف ومستراتيجيات التسويق.

customer-analysismachine-learningdata-insightsbusiness-intelligencemarketing-strategycustomer-discoveryfastapinumpyopenaipandasuvicornpython
31 9,223 44 1mo ago
py narro ◆ Documentation
Apache-2.0C+ 787/10completed

The Narro project is a lightweight CPU-based text-to-speech system designed for general use.

هو نظام تحويل النص إلى صوت خفيف الوزن يعمل على المعالج، مما يجعلها متاحة للعديد من الأجهزة والبرامج. تستخدم Narro مكتبات التعلم العميق الشعبية مثل Hugging Face و PyTorch لتحقيق الكلام الطبيعي من المدخلات النصية. مع التركيز على الفاعلية والمرونة، Narro خيار جذاب لل разработة لتدمج قدرات تحويل النص إلى صوت في مشاريعها.

text-to-speechcpu-basedmachine-learningnatural-speech-generationlightweight-ttshuggingfacenumpypytorchscipypython
33 6,413 78 1mo ago
py ctk ◆ Web Backend
MITC 617/10completed

The Conversation Toolkit (CTK) is a powerful, plugin-based system for managing AI conversations from multiple providers.

يعد أداة الحوار (CTK) نظامًا قويًا ومستندًا على إضافة الملحقات لتعامل مع حوارات الذكاء الاصطناعي من مزودين متعددين. يمكن للمستخدمين استيراد وتخزين وبحث واستخراج محادثاتهم في صيغة شجرة موحدة بينما يحتفظ بتفاصيل المزود الخاصة.

conversation-managementai-conversationsplugin-based-systemuniversal-tree-formatfull-text-searchnatural-language-queriesalembicnumpypydanticrichscikit-learnsqlalchemypython
233 77,963 61 1mo ago
If a scraper extracted this row, it came from Repobility (https://repobility.com)
ya unfinished symphony ◆ Web Frontend
AI FixesD 573/10completed

个人前端作品集网站,通过 AI 自然语言对话管理作品数据。

nextjsprismareacttailwindzodyaml
73 11,870 57 1mo ago
py AutoTrading ◆ Testing
C 645/10completed

This project is a modular stock market backtesting system designed for traders and analysts.

هذا المشروع هو نظام إعادة اختبار السوق المالية المكون من أجزاء، مصمم للاستخدام من قبل التجار والمحللين. يسمح المستخدمون بإنشاء واختبار وتقييم استراتيجيات التداول في طريقة مدمجة ومجديدة. يستخدم النظام مكتبات العلوم البيانية الشهيرة مثل NumPy و pandas و plotly لتعامل مع datasets كبيرة والتصوير النتائج. يُستخدم Streamlit لتوفير واجهة تعمل بالتفاعل للمستخدمين للENTRY من المعلمات والمشاهدة للخروجات. هذا المشروع يسعى إلى بسط عملية إعادة الاختبار وتحفيز التجار على اتخاذ قرارات أكثر ذكاءً.

stock-marketbacktestingtrading-strategiesdata-sciencealgorithmic-tradingtechnical-analysisnumpypandasplotlystreamlitpython
100 16,653 63 1mo ago
ya readium playground ◆ Web Frontend
AI FixesD 573/10completed

A demo project for exploring and testing Readium implementations.

reacttailwindvitezodyaml
Same scanner, your repo: https://repobility.com — Repobility
45 5,496 56 1mo ago
py qbraid algorithms ◆ Testing
Apache-2.0C+ 805/10completed

This project provides a Python package for working with quantum algorithms in OpenQASM 3.

هذا المشروع هو حزمة برمجية لغة بايثون تتيح للمستخدمين استخدام و تنفيذ و بناء الخوارزميات الكمية باستخدام OpenQASM 3. يوفّر هذا الحزمة إطارًا للعمل مع الخوارزميات الكمية، مما يجعل من السهل تطوير وتجريب هذه العمليات المعقدة. يمكن للمستخدمين توسيعها و تخصيصها لتحقيق احتياجاتهم الخاصة.

quantum-algorithmsopenqasm-3algorithm-developmentquantum-computingcomputational-complexitynumpyrichscipytyperpython
137 13,079 79 1mo ago
py lox ◆ Web Backend
C 627/10completed

The lox project is a discretionary macro research platform designed to help users manage their portfolios systematically.

هو منصة بحث مالي متعمدة توفر أدوات منهجية لادارة المحفظة الاستثمارية. يقدم مجموعة من الميزات والλειان، بما في ذلك تحليل البيانات وتحليلها، لمساعدة المستخدمين على اتخاذ قرارات استثمارية مدروسة.

portfolio-managementmacro-researchdata-analysisvisualizationinvestment-decision-makingregime-aware-portfolio-managementflaskgunicornmatplotlibnumpyopenaipandaspydanticrichpython
277 48,673 61 1mo ago
py imgui bundle ◆ Testing
AI FixesMITD 595/10completed
Repobility — the code-quality scanner for AI-generated software · https://repobility.com

The imgui-bundle project provides a fast and feature-rich GUI toolkit for C++ and Python applications.

هذا المشروع مجموعة من الأدوات وال бібліوتكيات التي تسمح بإنشاء واجهات مستخدم رسومية قوية في وقت قصير. يدعم اللغة البرمجية C++ وبرمجة بايثون، مما يجعلها حلًا متوافقًا مع عدة منصات للتنفيذ. يحتوي imgui-bundle على ميزات مثل التصفح السريع والخيارات المتقدمة للاستخدام والcompatiblity مع عدة منصات.

gui-toolkitcross-platformfast-renderinghigh-customizationpython-libraryc++-librarymatplotlibnumpypydanticrichpython
633 111,426 59 1mo ago
AI FixesD 517/10completed

Automated processing of scanned dollar bills to identify fancy serial numbers and prepare bills for eBay listing.

هذا المشروع هو نظام جاهز للتصديق الذي يستخدم نهج YOLO Detection hybrid لProcessing الملفات المسحاة من دولار. يIDENTIFY الأرقام المتقنة ويتجه للتحضير للملصقات على إيباي. يتألف النظام من خليط YOLOv8 + EasyOCR، والذي يحقق 100% rate detection في datasets الاختبار ويعالج حتى 176 ملفات في الدقيقة على CPU.

fancy-serial-number-detectiondollar-bill-processingebay-listing-preparationyolo-detectioneasyocrnumpypandaspytorchpython
357 31,421 51 1mo ago
py atlas Ai Ml
AI FixesMITF 469/10completed

Build a cognitive atlas from your behavioral traces, mapping your mind's territories and thought patterns.

هذا المشروع يخلق خريطة نفسية من بيانات سلوكك، مما يسمح لك بتصفية مناطق تفكيرك ونمطيات فكرك. يتم استخدام التضمين الخام باستخدام Gemini embeddings، ويتم投يقها إلى 2D باستخدام UMAP، ويتم تجميع البيانات باستخدام HDBSCAN، ويتم إنشاء صور لكل منطقة باستخدام LLMs. يحتوي الإخراج على خريطة نفسية محمولة في صيغة JSON، وصور قابلة للقراءة من قبل البشر في صيغة Markdown، ومخروط تفاعلي 2D في صيغة HTML.

cognitive-atlasbehavioral-tracestext-analysisdimensionality-reductionclusteringportrait-generationnumpyplotlyscipypython
7 1,102 46 1mo ago
Repobility (the analyzer behind this table) · https://repobility.com
py gently ◆ Web Backend
AI FixesMITD 549/10completed

Gently is a project that enables safe agentic microscopy by integrating vision language models with microscope hardware, allowing for AI-assisted development and rapid iteration without risking hardware.

يُستخدم Gently لدمج النماذج اللغوية للرؤية مع hardware الميكروسكوب، مما يسمح بالتطوير المساعد من خلال الذكاء الاصطناعي و التكرار السريع دون خطر على hardware. يدعم Gently كلا النهجين workflow و agent لدمج VLMs مع hardware الميكروسكوب. architecture safety تقدم طبقات حماية مستقلّة متعددة، بما في ذلك isolation process، limits device، constraints plan، actions templated، و cleanup automatic.

vision-language-modelsmicroscopyagentic-approachworkflow-approachsafety-architecturedevice-limitsanthropicfastapinumpyscipyuvicornpython
288 89,793 53 1mo ago
py mc project ◆ Web Backend
AI FixesF 415/10completed

This project is a machine learning-based application for data analysis and visualization.

هذا المشروع هو تطبيق برمجي يستخدم تقنيات التعلم الآلي والتحليل البياني لتقديم قدرات التحليل والتصوير البياني للبيانات. يعتبر هذا التطبيق مناسبًا للمستخدمين الذين يحتاجون إلى استكشاف وتحليل البيانات المعقدة. يتضمن المشروع وظائف تحليل البيانات وتصميم الميزات والتصوير البياني التفاعلي.

data-analysisdata-visualizationmachine-learninginteractive-toolsdata-manipulationfeature-engineeringnumpypandasstreamlitpython
55 50,736 41 1mo ago
py footfall count Data Tool
AI FixesF 483/10completed

This project is a footfall counter, likely used in retail or commercial settings to track pedestrian traffic.

هذا المشروع هو مقياس مرور الأقدام، يُستخدم في بيئات تجارية أو تجارية لمراقبة حركة المشاة. يتم بناؤه باستخدام Python و يستفيد من مكتبة numpy. بدون مزيد من المعلومات، لا يزال غير واضح كيف سيتم استخدام هذه البيانات أو تخزينها.

footfall-countingpedestrian-traffic-trackingretail-analyticscommercial-insightstraffic-monitoringnumpypython
If a scraper extracted this row, it came from Repobility (https://repobility.com)
9 1,257 48 1mo ago
py cerberus mcp ◆ Testing
MITC 687/10completed

The cerberus-context project provides a tool for AI agents to explore and understand code using AST-based analysis.

cerberus-context هو أداة استكشاف كود تستند إلى تحليل AST مصممة ل एजENTS الذكية. يستخدم ذاكرة الجلسة لتمكين التحليل من بنية الكود، مما يسمح لل أجENTS بفهم وتفاعل مع البرمجيات بشكل أكثر فعالية.

code-explorationast-analysissession-memoryai-agentscode-completiondebugginghuggingfacenumpypydanticrichscikit-learnpython
367 95,328 68 1mo ago
py panicradar ◆ Web Frontend
C 627/10completed

This project collects live crypto sentiment data to help predict price movements.

هذا المشروع يجمع بيانات الرأي العام عن العملات الرقمية الحية لتحديد حركات الأسعار. يستخدم هذا الأداة تحليل البيانات باستخدام خوارزميات التعلم الآلي، وخاصة تلك الموجودة في مكتبة Hugging Face's Transformers، لتنبؤ حركات الأسعار بناءً على بيانات الرأي العام المجمعة.

crypto-sentiment-analysisprice-predictionmachine-learningnatural-language-processingdata-aggregationcryptocurrency-market-insightsbeautifulsoupfastapihuggingfacenginxnumpypandaspydanticpytorchpython
199 35,966 62 1mo ago
py LIOTHIL ◆ Testing
MITC+ 737/10completed
Same scanner, your repo: https://repobility.com — Repobility

The dimljus project is a video LORA training toolkit designed for diffusion transformer models.

dimljus هو أداة تدريب لورا للفيديو مصممة خصيصًا للmodeleس الترانسفورميشنية التفجيرية. يوفّر مجموعة من الأدوات والخصائص لتسهيل عملية تدريب هذه الموديلات بفاعلية. تتمحور مهمة أداة dimljus حول تسهيل عملية التدريب، مما يجعلها أكثر سهولة للباحثين والمطورين. باستخدام أداة dimljus، يمكن المستخدمين تجربة مختلف التكوينات والمتغيرات الحاسمة لتحقيق النتائج الأمثل.

video-processingdiffusion-transformermodel-trainingdeep-learningartificial-intelligencemachine-learninghuggingfacenumpypydanticpytorchrichpython
263 50,559 73 1mo ago
py vector plus studio ◆ Web Frontend
AI FixesMITF 459/10completed

Vector+ Studio is a semantic search application powered by a Hopfield network, enabling real neural physics-based search results through associative memory.

Vector+ Studio هو تطبيق بحث semanticsي يستخدم شبكة Hopfield المكونة من 16 مليون نواة لتشغيل وظيفته البحثية. يختلف هذا التطبيق عن قواعد البيانات المتوافقة مع الفكريات التقليدية، حيث يتم تمرير الاستفسارات عبر الفيزياء العصبية الحقيقية، حيث تُشكل شبكة اللاتس المكونة من النوى بشكل فعال نتائج البحث من خلال الذاكرة المرتبطة، وليس فقط تشابه الكوسين.

semantic-searchphysics-enhanced-searchassociative-memoryreal-neural-physicshopfield-networkfull-crud-operationshuggingfacenumpystreamlitpython
50 12,652 44 1mo ago
py membot ◫ Data/ML
AI FixesMITD 519/10completed

Membot is a brain cartridge server for AI agents, providing swappable and searchable memory stored on a neuromorphic substrate.

هو سرور كارت ذاكرة للمعاقص الآلي، يوفر الوصول إلى الذاكرة القابلة للتغيير والبحثية المخزنة على سطح عصبي. يستخدم مسار بحث ثلاثي الإشارات للاستحواذ على النتائج التي يmiss أي طريقة واحدة. يتضمن المسار إشارة الكوسين، إشارة هامنج البيني، وترتيب الكلمات. تم بناء Membot على محرك لاتيس فيكتور +.

memory-managementsearch-engineneuromorphic-computingartificial-intelligencemachine-learningswappable-memoryhuggingfacenumpypython
20 5,621 51 1mo ago